
NBP1-52862 DCAF4 antibody

See related secondary antibodies

Search for all "DCAF4"

Quick Overview

Rabbit anti Human DCAF4

Product Description for DCAF4

Rabbit anti Human DCAF4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for DCAF4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp434K114, MGC20547, MGC46524, WDR21
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to WDR21A(WD repeat domain 21A) The peptide sequence was selected from the middle region of WDR21A. Peptide sequence GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT.
Background WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 26094

Accessory Products

  • LinkedIn