NBP1-94180 DCDC2C antibody

See related secondary antibodies

Search for all "DCDC2C"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DCDC2C

Product Description for DCDC2C

Rabbit anti Human DCDC2C.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DCDC2C

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B8J4L8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLVQRGAEGDVYKAPTPSKETQGALDVKEEHNVQLEVPVDQ
GeneID:
7285970
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 7285970

Accessory Products

  • LinkedIn