TA331810 DCDC5 antibody

Rabbit Polyclonal Anti-DCDC5 Antibody

See related secondary antibodies

Search for all "DCDC5"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rabbit DCDC5

Product Description for DCDC5

Rabbit anti Human, Rabbit DCDC5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DCDC5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Doublecortin domain-containing protein 5, KIAA1493
Presentation Purified
Reactivity Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-DCDC5 Antibody is: synthetic peptide directed towards the N-terminal region of Human DCDC5. Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn