discontinued

H00023576-B02P DDAH1 antibody

See related secondary antibodies

Search for all "DDAH1"

Quick Overview

Mouse anti Human DDAH1

Product Description for DDAH1

Mouse anti Human DDAH1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DDAH1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DDAH, DDAH-1, DDAHI, Dimethylargininase-1, Dimethylarginine dimethylaminohydrolase 1, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O94760
Immunogen:
DDAH1 (NP_036269, 1 a.a. ~ 285 a.a) full-length human protein.
AA Sequence:
MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVF VEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAE ILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIP NKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
GeneID:
23576
Remarks:
Gene Accession: NM_012137
Add. information Mouse polyclonal antibody raised against a full-length human DDAH1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 23576

Accessory Products

Proteins and/or Positive Controls

Proteins for DDAH1 (9 products)

Catalog No. Species Pres. Purity   Source  

DDAH1 (transcript variant 1)

DDAH1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DDAH1 (1-285, His-tag)

DDAH1 Human Purified > 95 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

DDAH1 (1-285, His-tag)

DDAH1 Human Purified > 95 % E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified
  Novus Biologicals Inc.

DDAH1

DDAH1 Human Purified
  Novus Biologicals Inc.

Positive controls for DDAH1 (2 products)

Catalog No. Species Pres. Purity   Source  

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn