TA334438 DDAH1 antibody

Rabbit Polyclonal Anti-DDAH1 Antibody

See related secondary antibodies

Search for all "DDAH1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DDAH1

TA334438

More Views

  • TA334438

Product Description for DDAH1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DDAH1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for DDAH1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DDAH, DDAH-1, DDAHI, Dimethylargininase-1, Dimethylarginine dimethylaminohydrolase 1, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94760
Immunogen:
The immunogen for anti-DDAH1 antibody: synthetic peptide directed towards the middle region of human DDAH1. Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT.
GeneID:
23576
Application WB
IHC
Background DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Sequence Note: AB001915.1 is a chimeric sequence. Only the DDAH1 region was propagated into this RefSeq record. [6/17/03, RefSeq staff]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DDAH1 (9 products)

Catalog No. Species Pres. Purity   Source  

DDAH1 (transcript variant 1)

DDAH1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DDAH1 (1-285, His-tag)

DDAH1 Human Purified > 95 % E. coli
0.5 mg / €750.00
  OriGene Technologies GmbH

DDAH1 (1-285, His-tag)

DDAH1 Human Purified > 95 % E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DDAH1

DDAH1 Human Purified
  Novus Biologicals Inc.

DDAH1

DDAH1 Human Purified
  Novus Biologicals Inc.

Positive controls for DDAH1 (2 products)

Catalog No. Species Pres. Purity   Source  

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)

DDAH1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn