
NBP1-53202 DDT antibody

See related secondary antibodies

Search for all "DDT"

Quick Overview

Rabbit anti Human DDT

Product Description for DDT

Rabbit anti Human DDT.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for DDT

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DDCT
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to DDT(D-dopachrome tautomerase) The peptide sequence was selected from the N terminal of DDT. Peptide sequence PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS.
Background D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. It is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn