discontinued

H00010522-D01P DEAF1 antibody

See related secondary antibodies

Search for all "DEAF1"

Quick Overview

Rabbit anti Human, Mouse DEAF1

H00010522-D01P

More Views

  • H00010522-D01P
  • H00010522-D01P

Product Description for DEAF1

Rabbit anti Human, Mouse DEAF1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DEAF1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Deformed epidermal autoregulatory factor 1 homolog, NUDR, Nuclear DEAF-1-related transcriptional regulator, SPN, Suppressin, ZMYND5, Zinc finger MYND domain-containing protein 5
Presentation Purified
Reactivity Hu, Ms
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75398
Immunogen:
DEAF1 (NP_066288.2, 1 a.a. ~ 565 a.a) full-length human protein.
AA Sequence:
MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAGGEAEEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHM DMGAEALPGPDEAAAAAAFAEVTTVTVANVGAAADNVFTTSVANAASISGHVLSGRTALQIGDSLNTEKATLIVVH TDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCI KQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPYKRRK KENELPTTPVKKDSPKNITLLPATAATTFTVTPSGQITTSGALTFDRASTVEATAVISESPAQGDVFAGATVQEAS VQPPCRASHPEPHYPGYQDSCQIAPFPEAALPTSHPKIVLTSLPALAVPPPTPTKAAPPALVNGLELSEPRSWLYL EEMVNSLLNTAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKD WKDHQHICGQSAAVTVQADEVHVAESVMEKVTV
GeneID:
10522
Remarks:
Gene Accession: NM_021008.2
Add. information Rabbit polyclonal antibody raised against a full-length human DEAF1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 10522

Accessory Products

Proteins and/or Positive Controls

Proteins for DEAF1 (7 products)

Catalog No. Species Pres. Purity   Source  

DEAF1

DEAF1 Human Purified
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DEAF1 (1 products)

Catalog No. Species Pres. Purity   Source  

DEAF1 293T Cell Transient Overexpression Lysate(Denatured)

DEAF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn