discontinued

H00010522-M06 DEAF1 antibody

See related secondary antibodies

Search for all "DEAF1"

Quick Overview

Mouse anti Human DEAF1 3E6

Product Description for DEAF1

Mouse anti Human DEAF1 3E6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for DEAF1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Deformed epidermal autoregulatory factor 1 homolog, NUDR, Nuclear DEAF-1-related transcriptional regulator, SPN, Suppressin, ZMYND5, Zinc finger MYND domain-containing protein 5
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3E6
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75398
Immunogen:
DEAF1 (NP_066288, 133 a.a. ~ 222 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCR NISGTLYKNRLGSG
GeneID:
10522
Remarks:
Gene Accession: NM_021008
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a full length recombinant DEAF1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10522

Accessory Products

Proteins and/or Positive Controls

Proteins for DEAF1 (7 products)

Catalog No. Species Pres. Purity   Source  

DEAF1

DEAF1 Human Purified
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DEAF1

DEAF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DEAF1 (1 products)

Catalog No. Species Pres. Purity   Source  

DEAF1 293T Cell Transient Overexpression Lysate(Denatured)

DEAF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn