NBP1-94153 DEFB108B antibody

See related secondary antibodies

Search for all "DEFB108B"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DEFB108B

Product Description for DEFB108B

Rabbit anti Human DEFB108B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DEFB108B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 245911

Accessory Products

Proteins and/or Positive Controls

Proteins for DEFB108B (1 products)

Catalog No. Species Pres. Purity   Source  

Defensin, beta 108B (DEFB108B)

Defensin, beta 108B (DEFB108B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for DEFB108B (1 products)

Catalog No. Species Pres. Purity   Source  

DEFB108B overexpression lysate

DEFB108B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn