discontinued

NBP1-94089 DEFB116 antibody

See related secondary antibodies

Search for all "DEFB116"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human DEFB116

Product Description for DEFB116

Rabbit anti Human DEFB116.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DEFB116

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q30KQ4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY
GeneID:
245930
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 245930

Accessory Products

Proteins and/or Positive Controls

Proteins for DEFB116 (2 products)

Catalog No. Species Pres. Purity   Source  

DEFB116 (24-102, His-tag)

DEFB116 Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

DEFB116 (24-102, His-tag)

DEFB116 Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH
  • LinkedIn