NBP1-94089 DEFB116 antibody

See related secondary antibodies

Search for all "DEFB116"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DEFB116

Product Description for DEFB116

Rabbit anti Human DEFB116.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DEFB116

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q30KQ4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY
GeneID:
245930
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 245930

Accessory Products

Proteins and/or Positive Controls

Proteins for DEFB116 (2 products)

Catalog No. Species Pres. Purity   Source  

DEFB116 (24-102, His-tag)

DEFB116 Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

DEFB116 (24-102, His-tag)

DEFB116 Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH
  • LinkedIn