discontinued

NBP1-90695 DEFB118 antibody

See related secondary antibodies

Search for all "DEFB118"

Quick Overview

Rabbit anti Human DEFB118

Product Description for DEFB118

Rabbit anti Human DEFB118.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DEFB118

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PH6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS
GeneID:
117285
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 117285

Accessory Products

Proteins and/or Positive Controls

Proteins for DEFB118 (3 products)

Catalog No. Species Pres. Purity   Source  

DEFB118 (21-123, His-tag)

DEFB118 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

DEFB118 (21-123, His-tag)

DEFB118 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Defensin, beta 118 (DEFB118)

Defensin, beta 118 (DEFB118) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for DEFB118 (1 products)

Catalog No. Species Pres. Purity   Source  

DEFB118 overexpression lysate

DEFB118 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn