TA344235 Dematin antibody

Rabbit Polyclonal Anti-DMTN Antibody - C-terminal region

See related secondary antibodies

Search for all "Dematin"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Dematin

Product Description for Dematin

Rabbit anti Human Dematin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Dematin

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DMT, EPB49, Erythrocyte membrane protein band 4.9
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08495
Immunogen:
The immunogen for Anti-DMTN antibody is: synthetic peptide directed towards the C-terminal region of Human DMTN. Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA.
GeneID:
2039
Application WB
Background Dematin, or EPB49, is an actin-bundling protein origilly identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kise and is restored after dephosphorylation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Dematin (5 products)

Catalog No. Species Pres. Purity   Source  

Dematin (transcript variant 1)

Dematin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Dematin (transcript variant 3)

Dematin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Dematin (transcript variant 2)

Dematin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Dematin

Dematin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dematin

Dematin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Dematin (5 products)

Catalog No. Species Pres. Purity   Source  

DMTN overexpression lysate

DMTN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DMTN overexpression lysate

DMTN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DMTN overexpression lysate

DMTN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DMTN overexpression lysate

DMTN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

EPB49 293T Cell Transient Overexpression Lysate(Denatured)

EPB49 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn