discontinued

H00163486-B01 DENND1B antibody

See related secondary antibodies

Search for all "DENND1B"

Quick Overview

Mouse anti Human DENND1B

Product Description for DENND1B

Mouse anti Human DENND1B.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DENND1B

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms C1orf218, Connecdenn 2, DENN domain-containing protein 1B, FAM31B
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P3S1
Immunogen:
DENND1B (NP_659414, 1 a.a. ~ 396 a.a) full-length human protein.
AA Sequence:
MAAAPREEKRWPQPVFSNPVVLWKFPEDFGDQEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCR LTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVHSYFIAPDVTGLP TIPESRNLTEYFVAVDVNNMLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLPPHLLDYCC APMPYLIGIHSSLIERVKNKSLEDVVMLNVDTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGVARAFLRAQ AALFGYYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEEITSGG FCGGKDKLQYDYPFSQ
GeneID:
163486
Remarks:
Gene Accession: NM_144977
Add. information Mouse polyclonal antibody raised against a full-length human DENND1B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 163486

Accessory Products

Proteins and/or Positive Controls

Proteins for DENND1B (3 products)

Catalog No. Species Pres. Purity   Source  

DENND1B (full length, N-term HIS tag, transcript variant 2)

DENND1B Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

DENND1B

DENND1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DENND1B

DENND1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DENND1B (3 products)

Catalog No. Species Pres. Purity   Source  

DENND1B 293T Cell Transient Overexpression Lysate(Denatured)

DENND1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DENND1B Lysate

Western Blot: DENND1B Lysate [NBL1-08314] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf218 Protein
  Novus Biologicals Inc.

DENND1B overexpression lysate

DENND1B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn