TA340372 DENND1B antibody

Rabbit Polyclonal Anti-DENND1B Antibody

See related secondary antibodies

Search for all "DENND1B"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DENND1B

Product Description for DENND1B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DENND1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DENND1B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C1orf218, Connecdenn 2, DENN domain-containing protein 1B, FAM31B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P3S1
Immunogen:
The immunogen for anti-DENND1B antibody: synthetic peptide directed towards the middle region of human DENND1B. Synthetic peptide located within the following region: PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY.
GeneID:
163486
Application WB
Background DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DENND1B (3 products)

Catalog No. Species Pres. Purity   Source  

DENND1B (full length, N-term HIS tag, transcript variant 2)

DENND1B Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

DENND1B

DENND1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DENND1B

DENND1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DENND1B (3 products)

Catalog No. Species Pres. Purity   Source  

DENND1B 293T Cell Transient Overexpression Lysate(Denatured)

DENND1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DENND1B Lysate

Western Blot: DENND1B Lysate [NBL1-08314] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf218 Protein
  Novus Biologicals Inc.

DENND1B overexpression lysate

DENND1B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn