NBP1-93633 DENND4B antibody

See related secondary antibodies

Search for all "DENND4B"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DENND4B

Product Description for DENND4B

Rabbit anti Human DENND4B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DENND4B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75064
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DSNLNTTCPFCACPFVPLLSVQTLDSRPSVPSPKSAGASGSKDAPVPGGPGPVLSDRRLCLALDEPQLCNGHMGGASRRVESGAWAYLSPLVLRKELES
GeneID:
9909
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 9909

Accessory Products

Proteins and/or Positive Controls

Proteins for DENND4B (1 products)

Catalog No. Species Pres. Purity   Source  

DENN/MADD domain containing 4B (DENND4B)

DENN/MADD domain containing 4B (DENND4B) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for DENND4B (1 products)

Catalog No. Species Pres. Purity   Source  

DENND4B overexpression lysate

DENND4B overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn