discontinued

H00008562-M01 DENR / DRP1 antibody

See related secondary antibodies

Search for all "DENR / DRP1"

Quick Overview

Mouse anti Human DENR / DRP1 1H3

H00008562-M01

More Views

  • H00008562-M01

Product Description for DENR / DRP1

Mouse anti Human DENR / DRP1 1H3.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for DENR / DRP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DRP, Density-regulated protein, H14, SMAP-3, Smooth muscle cell-associated protein 3
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1H3
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O43583
Immunogen:
DENR (NP_003668, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQ EAGIS*
GeneID:
8562
Remarks:
Gene Accession: NM_003677
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant DENR.

Antibody Reactive Against Recombinant Protein.
Application ELISA,RNAi-Ab,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8562

Accessory Products

Proteins and/or Positive Controls

Proteins for DENR / DRP1 (7 products)

Catalog No. Species Pres. Purity   Source  

DENR / DRP1

DENR / DRP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DENR / DRP1 (1-198, His-tag)

DENR / DRP1 Human Purified > 85 % E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

DENR / DRP1 (1-198, His-tag)

DENR / DRP1 Human Purified > 85 % E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

DENR / DRP1

DENR / DRP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DENR / DRP1

DENR / DRP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DENR / DRP1

DENR / DRP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DENR / DRP1

DENR / DRP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DENR / DRP1 (2 products)

Catalog No. Species Pres. Purity   Source  

DENR 293T Cell Transient Overexpression Lysate(Denatured)

DENR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DENR Lysate

Western Blot: DENR Lysate [NBL1-09832] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DENR
  Novus Biologicals Inc.
  • LinkedIn