discontinued

H00001716-M02 Deoxyguanosine kinase antibody

See related secondary antibodies

Search for all "Deoxyguanosine kinase"

Quick Overview

Mouse anti Human Deoxyguanosine kinase 3E9

H00001716-M02

More Views

  • H00001716-M02

Product Description for Deoxyguanosine kinase

Mouse anti Human Deoxyguanosine kinase 3E9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Deoxyguanosine kinase

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DGK, DGUOK
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3E9
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16854
Immunogen:
DGUOK (-, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIF LFEPPESTAGALP*
GeneID:
1716
Remarks:
Gene Accession: NM_001929
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant DGUOK.

Antibody Reactive Against Recombinant Protein.
Application ELISA,RNAi-Ab,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1716

Accessory Products

Proteins and/or Positive Controls

Proteins for Deoxyguanosine kinase (6 products)

Catalog No. Species Pres. Purity   Source  

Deoxyguanosine kinase (transcript variant 1)

Deoxyguanosine kinase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Deoxyguanosine kinase

Deoxyguanosine kinase Human in vitro transl.
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human
  Abnova Taiwan Corp.

Positive controls for Deoxyguanosine kinase (1 products)

Catalog No. Species Pres. Purity   Source  

Deoxyguanosine kinase Lysate

Western Blot: Deoxyguanosine kinase Lysate [NBL1-09856] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DGUOK
  Novus Biologicals Inc.
  • LinkedIn