TA337928 Deoxyguanosine kinase antibody

Rabbit Polyclonal Anti-DGUOK Antibody

See related secondary antibodies

Search for all "Deoxyguanosine kinase"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat Deoxyguanosine kinase

Product Description for Deoxyguanosine kinase

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat Deoxyguanosine kinase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Deoxyguanosine kinase

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DGK, DGUOK
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DGUOK antibody is: synthetic peptide directed towards the C-terminal region of Human DGUOK. Synthetic peptide located within the following region: EQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMRE.
Application WB
Background In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predomintly by two deoxyribonucleoside kises, cytosolic deoxycytidine kise and mitochondrial deoxyguanosine kise. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside alogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the alogs. Altertive splice variants encoding different protein isoforms have been described for this gene.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Deoxyguanosine kinase (6 products)

Catalog No. Species Pres. Purity   Source  

Deoxyguanosine kinase (transcript variant 1)

Deoxyguanosine kinase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €748.00

  OriGene Technologies, Inc.

Deoxyguanosine kinase

Deoxyguanosine kinase Human in vitro transl.
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human
  Abnova Taiwan Corp.

Deoxyguanosine kinase

Deoxyguanosine kinase Human
  Abnova Taiwan Corp.

Positive controls for Deoxyguanosine kinase (1 products)

Catalog No. Species Pres. Purity   Source  

Deoxyguanosine kinase Lysate

Western Blot: Deoxyguanosine kinase Lysate [NBL1-09856] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DGUOK
  Novus Biologicals Inc.
  • LinkedIn