TA329459 Deoxyribonuclease-2-beta antibody

Rabbit Polyclonal anti-DNASE2B antibody

See related secondary antibodies

Search for all "Deoxyribonuclease-2-beta"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Deoxyribonuclease-2-beta

Product Description for Deoxyribonuclease-2-beta

Rabbit anti Human Deoxyribonuclease-2-beta.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Deoxyribonuclease-2-beta

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DLAD, DNASE2B, DNase II-like acid DNase, DNase2-like acid DNase, Deoxyribonuclease II beta, Endonuclease DLAD
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DNASE2B antibody: synthetic peptide directed towards the C terminal of human DNASE2B. Synthetic peptide located within the following region: MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD.
Application WB
Background DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs.The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene.
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Deoxyribonuclease-2-beta (4 products)

Catalog No. Species Pres. Purity   Source  


Deoxyribonuclease-2-beta Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


Deoxyribonuclease-2-beta Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


Deoxyribonuclease-2-beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


Deoxyribonuclease-2-beta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn