TA343212 DEPDC6 / DEPTOR antibody

Rabbit Polyclonal Anti-DEPTOR Antibody

See related secondary antibodies

Search for all "DEPDC6 / DEPTOR"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DEPDC6 / DEPTOR

Product Description for DEPDC6 / DEPTOR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DEPDC6 / DEPTOR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DEPDC6 / DEPTOR

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DEP domain-containing mTOR-interacting protein, DEP domain-containing protein 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DEPTOR antibody is: synthetic peptide directed towards the middle region of Human DEPTOR. Synthetic peptide located within the following region: KSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSS.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 972% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DEPDC6 / DEPTOR (3 products)

Catalog No. Species Pres. Purity   Source  


DEPDC6 / DEPTOR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


DEPDC6 / DEPTOR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DEPDC6 / DEPTOR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DEPDC6 / DEPTOR (3 products)

Catalog No. Species Pres. Purity   Source  

DEPDC6 293T Cell Transient Overexpression Lysate(Denatured)

DEPDC6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DEPDC6 Lysate

Western Blot: DEPDC6 Lysate [NBL1-09835] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DEPDC6
  Novus Biologicals Inc.

DEPTOR overexpression lysate

DEPTOR overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn