TA335302 Derlin-3 antibody

Rabbit Polyclonal Anti-DERL3 Antibody

See related secondary antibodies

Search for all "Derlin-3"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Porcine, Rabbit, Rat, Zebrafish Derlin-3

Product Description for Derlin-3

Rabbit anti Bovine, Canine, Human, Porcine, Rabbit, Rat, Zebrafish Derlin-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Derlin-3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C22orf14, DER3, DERL3, Degradation in endoplasmic reticulum protein 3, Der1-like protein 3, LLN2
Presentation Purified
Reactivity Bov, Can, Hu, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DERL3 antibody: synthetic peptide directed towards the C terminal of human DERL3. Synthetic peptide located within the following region: YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP.
Application WB
Background DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several altertively spliced transcript variants encoding different isoforms have been identified for this gene.Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL3 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM].
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Derlin-3 (2 products)

Catalog No. Species Pres. Purity   Source  


Derlin-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


Derlin-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Derlin-3 (3 products)

Catalog No. Species Pres. Purity   Source  

DERL3 overexpression lysate

DERL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DERL3 overexpression lysate

DERL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DERL3 overexpression lysate

DERL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn