discontinued

H00050846-B01P Desert hedgehog / DHH antibody

See related secondary antibodies

Search for all "Desert hedgehog / DHH"

Quick Overview

Mouse anti Human Desert hedgehog / DHH

Product Description for Desert hedgehog / DHH

Mouse anti Human Desert hedgehog / DHH.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Desert hedgehog / DHH

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms HHG-3
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O43323
Immunogen:
DHH (NP_066382.1, 1 a.a. ~ 396 a.a) full-length human protein.
AA Sequence:
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRD LVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTS DRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAA DASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPG GDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGM HWYSRLLYRLAEELLG
GeneID:
50846
Remarks:
Gene Accession: NM_021044.2
Add. information Mouse polyclonal antibody raised against a full-length human DHH protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 50846

Accessory Products

Proteins and/or Positive Controls

Proteins for Desert hedgehog / DHH (11 products)

Catalog No. Species Pres. Purity   Source  

Desert hedgehog / DHH (N-term HIS tag)

Desert hedgehog / DHH Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 95 % > 95% by SDS PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 95 % > 95% by SDS PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified > 95.0% as determined by SDS-PAGE.  E. coli
  Acris Antibodies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified > 95.0% as determined by SDS-PAGE.  E. coli
  Acris Antibodies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified > 95.0% as determined by SDS-PAGE.  E. coli
  Acris Antibodies GmbH

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified
  Abnova Taiwan Corp.

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified
  Abnova Taiwan Corp.

Desert hedgehog / DHH

SDS-Page: Dhh Protein [NBC1-18407] - DHH, 22kDa (197aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for Desert hedgehog / DHH (1 products)

Catalog No. Species Pres. Purity   Source  

DHH 293T Cell Transient Overexpression Lysate(Denatured)

DHH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn