TA343152 Desert hedgehog / DHH antibody

Rabbit Polyclonal Anti-DHH Antibody

See related secondary antibodies

Search for all "Desert hedgehog / DHH"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Desert hedgehog / DHH

Product Description for Desert hedgehog / DHH

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Desert hedgehog / DHH.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Desert hedgehog / DHH

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms HHG-3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43323
Immunogen:
The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL.
GeneID:
50846
Application WB
Background Dhh is an intercellular sigl essential for a variety of patterning events during development. It may function as a spermatocyte survival factor in the testes and it is essential for testes development.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 911% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Desert hedgehog / DHH (11 products)

Catalog No. Species Pres. Purity   Source  

Desert hedgehog / DHH (N-term HIS tag)

Desert hedgehog / DHH Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 95 % > 95% by SDS PAGE E. coli
0.5 mg / €750.00
  OriGene Technologies GmbH

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 95 % > 95% by SDS PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified > 95.0% as determined by SDS-PAGE.  E. coli
  OriGene Technologies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified > 95.0% as determined by SDS-PAGE.  E. coli
  OriGene Technologies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified > 95.0% as determined by SDS-PAGE.  E. coli
  OriGene Technologies GmbH

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

Desert hedgehog / DHH (23-198, His-tag)

Desert hedgehog / DHH Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified
  Abnova Taiwan Corp.

Desert hedgehog / DHH

Desert hedgehog / DHH Human Purified
  Abnova Taiwan Corp.

Desert hedgehog / DHH

SDS-Page: Dhh Protein [NBC1-18407] - DHH, 22kDa (197aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for Desert hedgehog / DHH (1 products)

Catalog No. Species Pres. Purity   Source  

DHH 293T Cell Transient Overexpression Lysate(Denatured)

DHH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn