discontinued

NBP1-57642 Dfna5 deafness antibody

See related secondary antibodies

Search for all "Dfna5 deafness"

0.1 mg / €330.00

Quick Overview

Rabbit anti Human Dfna5 deafness

Product Description for Dfna5 deafness

Rabbit anti Human Dfna5 deafness.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Dfna5 deafness

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms ICERE-1
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4FVA8
Immunogen:
Synthetic peptides corresponding to DFNA5(deafness, autosomal dominant 5) The peptide sequence was selected from the C terminal of DFNA5. Peptide sequence AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR.
GeneID:
1687
Background Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in its gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 1687

Accessory Products

  • LinkedIn