discontinued

NBP1-57642 Dfna5 deafness antibody

See related secondary antibodies

Search for all "Dfna5 deafness"

Quick Overview

Rabbit anti Human Dfna5 deafness

Product Description for Dfna5 deafness

Rabbit anti Human Dfna5 deafness.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Dfna5 deafness

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms ICERE-1
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4FVA8
Immunogen:
Synthetic peptides corresponding to DFNA5(deafness, autosomal dominant 5) The peptide sequence was selected from the C terminal of DFNA5. Peptide sequence AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR.
GeneID:
1687
Background Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in its gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 1687

Accessory Products

  • LinkedIn