TA336101 DGAT2L3 / AWAT1 antibody

Rabbit Polyclonal Anti-AWAT1 Antibody

See related secondary antibodies

Search for all "DGAT2L3 / AWAT1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat DGAT2L3 / AWAT1

Product Description for DGAT2L3 / AWAT1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat DGAT2L3 / AWAT1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DGAT2L3 / AWAT1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Acyl-CoA wax alcohol acyltransferase 1, DGA2, Diacylglycerol O-acyltransferase 2-like protein 3, Long-chain-alcohol O-fatty-acyltransferase 1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-AWAT1 Antibody: synthetic peptide directed towards the N terminal of human AWAT1. Synthetic peptide located within the following region: LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVC.
Application WB
Background The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predomintly expressed in the sebaceous gland of the skin.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DGAT2L3 / AWAT1 (3 products)

Catalog No. Species Pres. Purity   Source  


DGAT2L3 / AWAT1 Human
  Abnova Taiwan Corp.


DGAT2L3 / AWAT1 Human Purified
  Abnova Taiwan Corp.


DGAT2L3 / AWAT1 Human Purified
  Abnova Taiwan Corp.

Positive controls for DGAT2L3 / AWAT1 (3 products)

Catalog No. Species Pres. Purity   Source  

AWAT1 Lysate

Western Blot: AWAT1 Lysate [NBL1-09846] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AWAT1
  Novus Biologicals Inc.

AWAT1 overexpression lysate

AWAT1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DGAT2L3 293T Cell Transient Overexpression Lysate(Denatured)

DGAT2L3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn