TA341994 DHRS7A antibody

Rabbit Polyclonal Anti-Dhrs7 Antibody

See related secondary antibodies

Search for all "DHRS7A"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHRS7A

TA341994

Product Description for DHRS7A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHRS7A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHRS7A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CGI-86, DHRS7, Dehydrogenase/reductase SDR family member 7, RETSDR4, Retinal short-chain dehydrogenase/reductase 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y394
Immunogen:
The immunogen for anti-Dhrs7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL.
GeneID:
51635
Application WB
Background The function of Dhrs7 remains unknown.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DHRS7A (2 products)

Catalog No. Species Pres. Purity   Source  

DHRS7A

DHRS7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DHRS7A

DHRS7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DHRS7A (2 products)

Catalog No. Species Pres. Purity   Source  

DHRS7 293T Cell Transient Overexpression Lysate(Denatured)

DHRS7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DHRS7 overexpression lysate

DHRS7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn