TA341594 DHX30 antibody

Rabbit Polyclonal Anti-DHX30 Antibody

See related secondary antibodies

Search for all "DHX30"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHX30

Product Description for DHX30

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DHX30.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DHX30

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DDX30, DEAH box protein 30, KIAA0890, Putative ATP-dependent RNA helicase DHX30
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DHX30 antibody: synthetic peptide directed towards the N terminal of human DHX30. Synthetic peptide located within the following region: AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH.
Application WB
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative R helicases.They are implicated in a number of cellular processes involving alteration of R secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The family member encoded byThis gene is a mitochondrial nucleoid protein that associates with mitochondrial D. It has also been identified as a component of a transcriptiol repressor complex that functions in retil development, and it is required to optimizeThe function ofThe zinc-finger antiviral protein. Altertively spliced transcript variants have been found forThis gene. [provided by RefSeq, Feb 2013].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DHX30 (1 products)

Catalog No. Species Pres. Purity   Source  

DHX30 (transcript variant 2)

DHX30 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for DHX30 (4 products)

Catalog No. Species Pres. Purity   Source  

DHX30 293T Cell Transient Overexpression Lysate(Denatured)

DHX30 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DHX30 Lysate

Western Blot: DHX30 Lysate [NBL1-09879] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHX30
  Novus Biologicals Inc.

DHX30 Lysate

Western Blot: DHX30 Lysate [NBL1-09880] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DHX30
  Novus Biologicals Inc.

DHX30 overexpression lysate

DHX30 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn