discontinued

H00056616-D01P DIABLO / SMAC antibody

See related secondary antibodies

Search for all "DIABLO / SMAC"

Quick Overview

Rabbit anti Human DIABLO / SMAC

Product Description for DIABLO / SMAC

Rabbit anti Human DIABLO / SMAC.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DIABLO / SMAC

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Diablo homolog mitochondrial, Direct IAP-binding protein with low pI, Second mitochondria-derived activator of caspase
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NR28
Immunogen:
DIABLO (NP_063940.1, 1 a.a. ~ 239 a.a) full-length human protein.
AA Sequence:
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRR AVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLK LETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERA ESEQEAYLRED
GeneID:
56616
Remarks:
Gene Accession: NM_019887
Add. information Rabbit polyclonal antibody raised against a full-length human DIABLO protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 56616

Accessory Products

Proteins and/or Positive Controls

Proteins for DIABLO / SMAC (12 products)

Catalog No. Species Pres. Purity   Source  

DIABLO / SMAC (transcript variant 2)

DIABLO / SMAC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DIABLO / SMAC (56-239)

DIABLO / SMAC Human Purified > 95 % > 95 % by SDS PAGE E. coli
0.5 mg / €990.00
  OriGene Technologies GmbH

DIABLO / SMAC (56-239)

DIABLO / SMAC Human Purified > 95 % > 95 % by SDS PAGE E. coli
0.1 mg / €340.00
  OriGene Technologies GmbH

DIABLO / SMAC

DIABLO / SMAC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DIABLO / SMAC

DIABLO / SMAC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DIABLO / SMAC

DIABLO / SMAC Human
  Abnova Taiwan Corp.

DIABLO / SMAC

DIABLO / SMAC Human
  Abnova Taiwan Corp.

DIABLO / SMAC

DIABLO / SMAC Human
  Abnova Taiwan Corp.

DIABLO / SMAC

SDS-Page: Smac Protein [NBC1-18509] - SMAC/Diablo, 22 kDa (199 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

DIABLO / SMAC (1-239)

Human DIABLO (Diablo homolog, mitochondrial) recombinant protein 6xHis-GST tagged Human Purified > 90 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-6xHis (WB) serum and peptide fingerprinting by MALDI-TOF-TOF mass spectrometry E. coli
  Protein Alternatives

DIABLO / SMAC (1-239)

Human DIABLO (Diablo homolog, mitochondrial) recombinant protein 6xHis-GST tagged Human Purified > 90 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-6xHis (WB) serum and peptide fingerprinting by MALDI-TOF-TOF mass spectrometry E. coli
  Protein Alternatives

DIABLO / SMAC (1-239)

Human DIABLO (Diablo homolog, mitochondrial) recombinant protein 6xHis-GST tagged Human Purified > 90 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-6xHis (WB) serum and peptide fingerprinting by MALDI-TOF-TOF mass spectrometry E. coli
  Protein Alternatives

Positive controls for DIABLO / SMAC (3 products)

Catalog No. Species Pres. Purity   Source  

DIABLO 293T Cell Transient Overexpression Lysate(Denatured)

DIABLO 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DIABLO overexpression lysate

DIABLO overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DIABLO overexpression lysate

DIABLO overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn