NBP1-88480 DIEXF antibody

See related secondary antibodies

Search for all "DIEXF"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DIEXF

Product Description for DIEXF

Rabbit anti Human DIEXF.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DIEXF

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68CQ4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
GeneID:
27042
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 27042

Accessory Products

Proteins and/or Positive Controls

Proteins for DIEXF (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 107 (C1orf107)

Chromosome 1 open reading frame 107 (C1orf107) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for DIEXF (2 products)

Catalog No. Species Pres. Purity   Source  

C1orf107 Lysate

Western Blot: C1orf107 Lysate [NBL1-08291] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf107 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

DIEXF overexpression lysate

DIEXF overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn