discontinued

NBP1-88480 DIEXF antibody

See related secondary antibodies

Search for all "DIEXF"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human DIEXF

Product Description for DIEXF

Rabbit anti Human DIEXF.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DIEXF

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68CQ4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
GeneID:
27042
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 27042

Accessory Products

Proteins and/or Positive Controls

Proteins for DIEXF (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 1 open reading frame 107 (C1orf107)

Chromosome 1 open reading frame 107 (C1orf107) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for DIEXF (2 products)

Catalog No. Species Pres. Purity   Source  

C1orf107 Lysate

Western Blot: C1orf107 Lysate [NBL1-08291] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1orf107 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

DIEXF overexpression lysate

DIEXF overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn