discontinued

H00001856-D01 Dishevelled-2 / DVL2 antibody

See related secondary antibodies

Search for all "Dishevelled-2 / DVL2"

Quick Overview

Rabbit anti Human Dishevelled-2 / DVL2

Product Description for Dishevelled-2 / DVL2

Rabbit anti Human Dishevelled-2 / DVL2.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for Dishevelled-2 / DVL2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms DSH homolog 2, DVL-2, Segment polarity protein dishevelled homolog DVL-2
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O14641
Immunogen:
DVL2 (NP_004413.1, 1 a.a. ~ 736 a.a) full-length human protein.
AA Sequence:
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNA RLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETE TESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSS ASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGA VAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWV SHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGS DVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASD QDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPE ERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVM MPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM
GeneID:
1856
Remarks:
Gene Accession: NM_004422
Add. information Rabbit polyclonal antibody raised against a full-length human DVL2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 1856

Accessory Products

Proteins and/or Positive Controls

Proteins for Dishevelled-2 / DVL2 (2 products)

Catalog No. Species Pres. Purity   Source  

Dishevelled-2 / DVL2

Dishevelled-2 / DVL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Dishevelled-2 / DVL2

Dishevelled-2 / DVL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Dishevelled-2 / DVL2 (3 products)

Catalog No. Species Pres. Purity   Source  

Dishevelled 2 Lysate

Western Blot: Dishevelled 2 Lysate [NBL1-10063] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DVL2
  Novus Biologicals Inc.

DVL2 293T Cell Transient Overexpression Lysate(Denatured)

DVL2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DVL2 overexpression lysate

DVL2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn