H00029774-B01P DKFZP434P211 antibody

See related secondary antibodies

Search for all "DKFZP434P211"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human DKFZP434P211

H00029774-B01P

Product Description for DKFZP434P211

Mouse anti Human DKFZP434P211.
Product is tested for Western blot / Immunoblot.

Properties for DKFZP434P211

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms UNQ2565
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
DKFZP434P211 (CAL37978.1, 1 a.a. ~ 428 a.a) full-length human protein.
AA Sequence:
MDSLWGPGAGSHPFGVHNTRLSPDLCPGKIVLRALKESGAGMPEQDKDPRVQENPGDQRRVPEVTGDARPAFRPLR DNGGLSPFVPGPGPLQTDLHAQRSEIRYNQTSQTSWTSSCTNRNAISSSYSSTGGLPGLKRRRGPASSHCQLTLSS SKTVSEDRPQAVSSGHTQCEKAADIAPGQTLTLRNDSSTSEASRPSTHKFPLLPRRRGEPLMLPPPLELGYRVTVE DLDREKEAAFQRINSALQVEDKAISDCRPSRPSHTLSSLATGASGLPAVSKAPSMDAQQETHKSQDCLGLLDPLAS AAGVPSTAPMSGKKHRPPGPLFSSSDPLPATSSDSQDSAQVTSLIPAPFPAASMDAGMRRTRHGTSAPAAAAAAPP RSTLNPTLGSLLEWMEALHISGPQPQLQQVPRGQNQRSQTSWTSSCPK
GeneID:
29774
Add. information Mouse polyclonal antibody raised against a full-length human DKFZP434P211 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn