H00091056-B01P DKFZp761E198 antibody

See related secondary antibodies

Search for all "DKFZp761E198"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human DKFZp761E198

H00091056-B01P

Product Description for DKFZp761E198

Mouse anti Human DKFZp761E198.
Product is tested for Western blot / Immunoblot.

Properties for DKFZp761E198

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms PP1030
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2VPB7
Immunogen:
DKFZp761E198 (NP_612377.2, 1 a.a. ~ 552 a.a) full-length human protein.
AA Sequence:
MLALKAAFGEALFTAQDEALLLRRLTLAAQHPALPPPTHLFYLHCVLSFPENWPLGPEGEEAAPLLLGPQLCRGLL PSLLHDPMALLARLHLLCLLCAEEEEEEKGQLPSPRHYLEELLAGLRQRAALDGGPRALATLCFQASYLVACCLAG QPTVLTPLIHGLAQLYQARPMLAPHFVDLLDQVDSELREPLKVVLRQVVVSRPGRDEALCWHLQMLAKVADGDAQS ATLNFLQAAAAHCTNWDLQQGLLRVCRALLRAGVRGGLVDLLQVLARQLEDPDGRDHARLYYILLAHLAAPKLGVA LGPSLAAPALASSLVAENQGFVAALMVQEAPALVRLSLGSHRVKGPLPVLKLQPEALEPIYSLELRFRVEGQLYAP LEAVHVPCLCPGRPARPLLLPLQPRCPAPARLDVHALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFF EELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHLPPDSKLLLRLEAALADGVPVALRT DDWAVLPLAGDYLRGLAAAV
GeneID:
91056
Add. information Mouse polyclonal antibody raised against a full-length human DKFZp761E198 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for DKFZp761E198 (1 products)

Catalog No. Species Pres. Purity   Source  

AP5B1 overexpression lysate

AP5B1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn