discontinued

H00001742-D01P DLG4 / PSD95 antibody

See related secondary antibodies

Search for all "DLG4 / PSD95"

Quick Overview

Rabbit anti Human DLG4 / PSD95

Product Description for DLG4 / PSD95

Rabbit anti Human DLG4 / PSD95.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DLG4 / PSD95

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DLGH4, Disks large homolog 4, PSD-95, Postsynaptic density protein 95, SAP-90, SAP90, Synapse-associated protein 90
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q62108
Immunogen:
DLG4 (NP_001356.1, 1 a.a. ~ 767 a.a) full-length human protein.
AA Sequence:
MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQKYRYQDEDTPPLEHSPAHLPNQA NSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDG RLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPG DNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDIT TSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIF ISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMN SSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIP SKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPH TTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAA HLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIW VPARERL
GeneID:
13385
Remarks:
Gene Accession: NM_001365
Add. information Rabbit polyclonal antibody raised against a full-length human DLG4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human
Gene ID 13385

Accessory Products

Proteins and/or Positive Controls

Positive controls for DLG4 / PSD95 (1 products)

Catalog No. Species Pres. Purity   Source  

DLG4 293T Cell Transient Overexpression Lysate(Denatured)

DLG4 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-DLG4 antibody (H00001742-B01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn