discontinued

H00001743-B01 DLST MaxPab mouse antibody

See related secondary antibodies

Search for all "DLST MaxPab mouse"

50 µl / €370.00

Quick Overview

Mouse anti Human DLST MaxPab mouse

H00001743-B01

Product Description for DLST MaxPab mouse

Mouse anti Human DLST MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, ELISA capture and detection.

Properties for DLST MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms DLTS, E2 component of 2-oxo-glutarate complex, dihydrolipoamide S-succinyltransferase
Presentation Purified
Reactivity Hu
Applications E(caption)/E(detection), E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
DLST (NP_001924.2, 1 a.a. ~ 453 a.a) full-length human protein.
AA Sequence:
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTP AFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAK AKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMN RMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDD TTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSL FGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Remarks:
Gene Accession: NM_001933.3
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
None
State:
Purified

Accessory Products

  • LinkedIn