H00063947-B01P DMRTC1 antibody

See related secondary antibodies

Search for all "DMRTC1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human DMRTC1

H00063947-B01P

Product Description for DMRTC1

Mouse anti Human DMRTC1.
Product is tested for Western blot / Immunoblot.

Properties for DMRTC1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5HYR2
Immunogen:
DMRTC1 (AAI60151.1, 1 a.a. ~ 192 a.a) full-length human protein.
AA Sequence:
MAAPPKAPIRVRNLTIRAGALTGKENNMLQPETHIFTAPEEGSSQGALLLGQAPEPLSLPCTPVTLEQQLVSPSGD PHRAPALPSICSTLILQPCATLDPLLLQPQVPKVSDQALVSAHSEWQRKLEAAEALLTLRNSAQAPPDSISLHQPC NPPAPAGDKGFQPPSPSLRPRPASSISLPIGHLGCISLLS
GeneID:
63947
Add. information Mouse polyclonal antibody raised against a full-length human DMRTC1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for DMRTC1 (1 products)

Catalog No. Species Pres. Purity   Source  

DMRTC1

10ug of GTX117530-pro DMRTC1 recombinant protein analyzed using SDS-PAGE and stained with coomassie blue and captured by black and white camera. Purified Purified by conventional chromatography.
25 µg / €360.00
  GeneTex Inc.
  • LinkedIn