TA336235 DNA ligase 1 antibody

Rabbit Polyclonal Anti-LIG1 Antibody

See related secondary antibodies

Search for all "DNA ligase 1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit DNA ligase 1

Product Description for DNA ligase 1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit DNA ligase 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNA ligase 1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DNA ligase 1, DNA ligase I, EC=, LIG-1, LIG1, Polydeoxyribonucleotide synthase [ATP] 1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR.
Application WB
Background LIG1is D ligase I, with functions in D replication and the base excision repair process. Mutations in LIG1 that lead to D ligase I deficiency result in immunodeficiency and increased sensitivity to D-damaging agents.LIG1 encodes D ligase I, with functions in D replication and the base excision repair process. Mutations in LIG1 that lead to D ligase I deficiency result in immunodeficiency and increased sensitivity to D-damaging agents. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DNA ligase 1 (3 products)

Catalog No. Species Pres. Purity   Source  

DNA ligase 1

DNA ligase 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DNA ligase 1

DNA ligase 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DNA ligase 1

DNA ligase 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNA ligase 1 (1 products)

Catalog No. Species Pres. Purity   Source  

LIG1 overexpression lysate

LIG1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn