TA334470 DNA polymerase lambda antibody

Rabbit Polyclonal Anti-POLL Antibody

See related secondary antibodies

Search for all "DNA polymerase lambda"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat DNA polymerase lambda

Product Description for DNA polymerase lambda

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat DNA polymerase lambda.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNA polymerase lambda

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms DNA polymerase beta-2, DNA polymerase kappa, POLL, Pol Lambda
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-POLL antibody is: synthetic peptide directed towards the middle region of Human POLL. Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DNA polymerase lambda (4 products)

Catalog No. Species Pres. Purity   Source  

DNA polymerase lambda

DNA polymerase lambda Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DNA polymerase lambda

DNA polymerase lambda Human
  Abnova Taiwan Corp.

DNA polymerase lambda

DNA polymerase lambda Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

DNA polymerase lambda

DNA polymerase lambda Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for DNA polymerase lambda (2 products)

Catalog No. Species Pres. Purity   Source  

DNA Polymerase lambda Lysate

Western Blot: DNA Polymerase lambda Lysate [NBL1-14573] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POLL
  Novus Biologicals Inc.

POLL overexpression lysate

POLL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn