H00010721-M09 DNA polymerase theta antibody

See related secondary antibodies

Search for all "DNA polymerase theta"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human DNA polymerase theta 1C11

Product Description for DNA polymerase theta

Mouse anti Human DNA polymerase theta 1C11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for DNA polymerase theta

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms DNA polymerase eta, POLH, POLQ
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1C11
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6VMB5
Immunogen:
POLQ (-, 2572 a.a. ~ 2681 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
DGFVQTILGRRRYLPGIKDNNPYRKAHAERQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSD RTGLSRKRKLQGMFCPIRGGFFILQLHDELLYE*
GeneID:
10721
Remarks:
Gene Accession: NM_006596
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant POLQ.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10721

Accessory Products

  • LinkedIn