TA338968 DNA primase small subunit antibody

Rabbit Polyclonal Anti-PRIM1 Antibody

See related secondary antibodies

Search for all "DNA primase small subunit"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish DNA primase small subunit

Product Description for DNA primase small subunit

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish DNA primase small subunit.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNA primase small subunit

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DNA primase 49 kDa subunit, PRIM1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49642
Immunogen:
The immunogen for anti-PRIM1 antibody: synthetic peptide directed towards the N terminal of human PRIM1. Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM.
GeneID:
5557
Application WB
Background The replication of D in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which D polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small R primers for the Okazaki fragments made during discontinuous D replication. The protein encoded by this gene is the small, 49 kDa primase subunit. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNA primase small subunit (2 products)

Catalog No. Species Pres. Purity   Source  

DNA primase small subunit (p49)

DNA primase small subunit Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DNA primase small subunit (p49)

DNA primase small subunit Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNA primase small subunit (2 products)

Catalog No. Species Pres. Purity   Source  

DNA Primase small subunit Lysate

Western Blot: DNA Primase small subunit Lysate [NBL1-14755] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PRIM1
  Novus Biologicals Inc.

PRIM1 overexpression lysate

PRIM1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn