discontinued

NBP1-93818 DNAAF3 antibody

See related secondary antibodies

Search for all "DNAAF3"

Quick Overview

Rabbit anti Human DNAAF3

Product Description for DNAAF3

Rabbit anti Human DNAAF3.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DNAAF3

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms C19orf51, Dynein assembly factor 3 axonemal
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9W5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RGAQVIHPQEFRRWRDTGVAFELRDSSAYHVPNRTLASGRLLSYRGERVAARGYWGDIATGPFVAFGIEADDESLLRTSNGQPVKTAGEITQHNVTELL
GeneID:
352909
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 352909

Accessory Products

  • LinkedIn