discontinued

NBP1-90489 DNAH17 antibody

See related secondary antibodies

Search for all "DNAH17"

Quick Overview

Rabbit anti Human DNAH17

Product Description for DNAH17

Rabbit anti Human DNAH17.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DNAH17

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q94883
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQAMVAVRKHPG
GeneID:
34328
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 34328

Accessory Products

  • LinkedIn