F-MKA1697AF DNAH6 (KIAA1697) antibody

See related secondary antibodies

Search for all "DNAH6 (KIAA1697)"

50 µg / €680.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse DNAH6 (KIAA1697)

F-MKA1697AF

Product Description for DNAH6 (KIAA1697)

Rabbit anti Mouse DNAH6 (KIAA1697).
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAH6 (KIAA1697)

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Germany only
PDF datasheet View Datasheet
Manufacturer Funakoshi Co., Ltd.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5DTV6
Immunogen:
GX2241 (GST-fusion protein, 143 amino acids)LSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHFEPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQLSE.
Add. information Shipping conditions: Dry Ice
Storage -20℃
Format
State:
Aff - Purified

Accessory Products

  • LinkedIn