discontinued

H00054431-M02 DNAJC10 / ERDJ5 antibody

See related secondary antibodies

Search for all "DNAJC10 / ERDJ5"

Quick Overview

Mouse anti Human, Mouse, Rat DNAJC10 / ERDJ5 3A8

H00054431-M02

More Views

  • H00054431-M02
  • H00054431-M02
  • H00054431-M02
  • H00054431-M02

Product Description for DNAJC10 / ERDJ5

Mouse anti Human, Mouse, Rat DNAJC10 / ERDJ5 3A8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for DNAJC10 / ERDJ5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DnaJ homolog subfamily C member 10, ER-resident protein ERdj5, Macrothioredoxin
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E, WB
Clonality Monoclonal
Clone 3A8
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IXB1
Immunogen:
DNAJC10 (NP_061854, 688 a.a. ~ 794 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQI NTRDAKAIAALISEKLETLRNQGKRNKDEL*
GeneID:
54431
Remarks:
Gene Accession: NM_018981
Isotype control AM03095PU-N, SM10P (for use in human samples), SM20P (for use in rat samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant DNAJC10.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Ti
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 54431

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC10 / ERDJ5 (2 products)

Catalog No. Species Pres. Purity   Source  

DNAJC10 / ERDJ5

DNAJC10 / ERDJ5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DNAJC10 / ERDJ5

DNAJC10 / ERDJ5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNAJC10 / ERDJ5 (1 products)

Catalog No. Species Pres. Purity   Source  

DNAJC10 Lysate

Western Blot: DNAJC10 Lysate [NBL1-09944] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DNAJC10
  Novus Biologicals Inc.
  • LinkedIn