TA331073 DNAJC10 / ERDJ5 antibody

Rabbit polyclonal Anti-DNAJC10 Antibody

See related secondary antibodies

Search for all "DNAJC10 / ERDJ5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish DNAJC10 / ERDJ5

Product Description for DNAJC10 / ERDJ5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish DNAJC10 / ERDJ5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJC10 / ERDJ5

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms DnaJ homolog subfamily C member 10, ER-resident protein ERdj5, Macrothioredoxin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DNAJC10 antibody: synthetic peptide directed towards the N terminal of human DNAJC10. Synthetic peptide located within the following region: DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY.
Application WB
Background This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DJC10 may act as a co-chaperone for HSPA5.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC10 / ERDJ5 (2 products)

Catalog No. Species Pres. Purity   Source  


DNAJC10 / ERDJ5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DNAJC10 / ERDJ5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNAJC10 / ERDJ5 (1 products)

Catalog No. Species Pres. Purity   Source  

DNAJC10 Lysate

Western Blot: DNAJC10 Lysate [NBL1-09944] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DNAJC10
  Novus Biologicals Inc.
  • LinkedIn