H00085406-B01P DNAJC14 antibody

See related secondary antibodies

Search for all "DNAJC14"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human DNAJC14

H00085406-B01P

Product Description for DNAJC14

Mouse anti Human DNAJC14.
Product is tested for Western blot / Immunoblot.

Properties for DNAJC14

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DNAJ, DRIP78, HDJ3, LIP6
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6Y2X3
Immunogen:
DNAJC14 (ADR83105.1, 1 a.a. ~ 702 a.a) full-length human protein.
AA Sequence:
MAQKHPGERGLYGAHHSGGASLRTLGPSVDPEIPSFSGLRDSAGTAPNGTRCLTEHSGPKHTQHPNPAHWLDPSHG PPGGPGPPRDAEDPDQSETSSEEESGVDQELSKENETGNQKDGNSFLSIPSACNCQGTPGIPEGPYSEGGNGSSSN FCHHCTSPALGEDELEEEYDDEESLKFPSDFSRVSSGKKPPSRRQRHRFPTKEDTREGGRRDPRSPGRHRLGRKRS QADKRKGLGLWGAEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRQLKSSDLDLFRVWMGVWTGRLGGWAQV MFQFLSQGFYCGVGLFTRFLKLLGALLLLALALFLGFLQLGWRFLVGLGDRLGWRDKATWLFSWLDSPALQRCLTL LRDSRPWQRLVRIVQWGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASD VELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAM NTMMCSRCQGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEWAGCQRVGI SPDTHRVPYHISFGSRIPGTRGRQRATPDAPPADLQDFLSRIFQVPPGQMPNGNFFAAPQPAPGAAAASKPNSTVP KGEAKPKRRKKVRRPFQR
GeneID:
85406
Add. information Mouse polyclonal antibody raised against a full-length human DNAJC14 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC14 (1 products)

Catalog No. Species Pres. Purity   Source  

DnaJ (Hsp40) homolog, subfamily C, member 14 (DNAJC14)

DnaJ (Hsp40) homolog, subfamily C, member 14 (DNAJC14) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn