NBP1-90676 DNAJC14 antibody

See related secondary antibodies

Search for all "DNAJC14"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DNAJC14

NBP1-90676

More Views

  • NBP1-90676

Product Description for DNAJC14

Rabbit anti Human DNAJC14.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for DNAJC14

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NSI2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AFINTNIFARTKIDPSALVQKLELDVRSVTSVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKL
GeneID:
85395
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 85395

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC14 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 21 open reading frame 70 (C21orf70)

Chromosome 21 open reading frame 70 (C21orf70) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for DNAJC14 (2 products)

Catalog No. Species Pres. Purity   Source  

C21orf70 Lysate

Western Blot: C21orf70 Lysate [NBL1-08390] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LY409226. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

FAM207A overexpression lysate

FAM207A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn