discontinued

H00085479-B01P DNAJC5B antibody

See related secondary antibodies

Search for all "DNAJC5B"

Quick Overview

Mouse anti Human DNAJC5B

Product Description for DNAJC5B

Mouse anti Human DNAJC5B.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DNAJC5B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Beta cysteine string protein, Beta-CSP, DnaJ homolog subfamily C member 5B
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UF47
Immunogen:
DNAJC5B (NP_149096, 1 a.a. ~ 199 a.a) full-length human protein.
AA Sequence:
MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISK RSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFY VSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS
GeneID:
85479
Remarks:
Gene Accession: NM_033105
Add. information Mouse polyclonal antibody raised against a full-length human DNAJC5B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 85479

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC5B (3 products)

Catalog No. Species Pres. Purity   Source  

DNAJC5B

DNAJC5B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DNAJC5B

DNAJC5B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DNAJC5B

DNAJC5B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DNAJC5B (1 products)

Catalog No. Species Pres. Purity   Source  

DNAJC5B 293T Cell Transient Overexpression Lysate(Denatured)

DNAJC5B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn