
NBP1-91844 DNASE1L2 antibody

See related secondary antibodies

Search for all "DNASE1L2"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human DNASE1L2

Product Description for DNASE1L2

Rabbit anti Human DNASE1L2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for DNASE1L2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISD
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 1775

Accessory Products

Proteins and/or Positive Controls

Positive controls for DNASE1L2 (1 products)

Catalog No. Species Pres. Purity   Source  

DNASE1L2 overexpression lysate

DNASE1L2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn