TA344036 DND1 / RBMS4 antibody

Rabbit Polyclonal Anti-Dnd1 Antibody

See related secondary antibodies

Search for all "DND1 / RBMS4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat DND1 / RBMS4

Product Description for DND1 / RBMS4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat DND1 / RBMS4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DND1 / RBMS4

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Dead end protein homolog 1, RNA-binding motif single-stranded-interacting protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Dnd1 antibody is: synthetic peptide directed towards the middle region of Rat Dnd1. Synthetic peptide located within the following region: KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn