discontinued

H00008447-B01P DOC2B antibody

See related secondary antibodies

Search for all "DOC2B"

Quick Overview

Mouse anti Human DOC2B

H00008447-B01P

More Views

  • H00008447-B01P

Product Description for DOC2B

Mouse anti Human DOC2B.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DOC2B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DOC2BL, Doc2-beta, Double C2-like domain-containing protein beta
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14184
Immunogen:
DOC2B (AAI53025.1, 1 a.a. ~ 412 a.a) full-length human protein.
AA Sequence:
MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPARPAVAGAGRRSPSDGA REDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQENNALHCTITKAKG LKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFI GETRVPLKKLKPNHTKTFNICLEKQLPVDKTEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDP YVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKSLEVTVWDYDIGKSNDFIGGVVLGIHAKGER LKHWFDCLKNKDKRIERWHTLTSELPGAVLSD
GeneID:
8447
Remarks:
Gene Accession: BC153024
Add. information Mouse polyclonal antibody raised against a full-length human DOC2B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8447

Accessory Products

Proteins and/or Positive Controls

Proteins for DOC2B (3 products)

Catalog No. Species Pres. Purity   Source  

DOC2B

DOC2B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DOC2B

DOC2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DOC2B

DOC2B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DOC2B (1 products)

Catalog No. Species Pres. Purity   Source  

DOC2B 293T Cell Transient Overexpression Lysate(Denatured)

DOC2B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn